www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Oxyntomodulin

Oxyntomodulin

Quick view: Suppliers
BGC Id:
301994806582
CAS No.:
Synonyms:
hsqgtftsdyskyldsrraqdfvqwlmntkrnknnia | oxyntomodulin (porcine) | glucagon 37 | oxyntomodulin | enteroglucagon | m.w. 4421.86 c192h295n59o60s | enteroglucagon | glucagon (1-37) (porcine) | h-his-ser-gln-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-gln-asp-phe-val-gln-trp-leu-met-asn-thr-lys-arg-asn-lys-asn-asn-ile-ala-oh | glucagon 1-37
Formula:
C192H295N59O60S

List of Suppliers

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Ethyl 2-bromo-2,2-difluoroacetate is also served by BuGuCh & Partners. BuGuCh & Partners is supplier for Oxyntomodulin. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Most viewed

Within the past time user are also interested in the following chemicals.
DL-alpha-Phosphatidylcholine dipalmitoyl
Structure

Suppliers and manufactures - with identical CAS number as Oxyntomodulin

For the following products supplier are listed below:
    Glucagon (1-37) (porcine)
    Oxyntomodulin (porcine, bovine)


The following companies are not suppliers of Oxyntomodulin . This companies are suppliers for equal products with the same CAS number. CAS: 62340-29-8


Supplier of

Glucagon (1-37) (porcine)

(CAS: 62340-29-8)

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of (3S)-4-Acetyl-1,3-dihydro-1-oxo-5-[(1S)-1,3,3-trimethylcyclohexyl]isobenzofuran-3-ol acetate. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Supplier of

Oxyntomodulin (porcine, bovine)

(CAS: 62340-29-8)

polypeptide.ltd

Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees. Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). Glepaglutide is also served by polypeptide.ltd. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China   Phone: +86 152 1950 7320   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Zley Holdings (SuZhou)
The R&D group of ZLEY (WEINAN CHANGTONG PHARMACHEM TECH CO., LTD.)has spent 33 years cultivatin


Henan Sinowin Che
Henan Sinowin Chemical Industry Co.,Ltd. is established in 2003, it's located in Zhengzhou industri


Unilong Industry Co.,Lt
Unilong Industry Co.,Ltd. is a growing high-tech chemical enterprise, and located in Zibo Zhangdian


Chengdu Pufeide Biotech
Chengdu Pufeide Biotech. Co., Ltd. is a leading supplier of natural pure plant monomers at home and


Nanjing Fred Technology
Nanjing Fred technology Co., Ltd. is a high-tech enterprise engaged in the R&D, production and


Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Oxyntomodulin